SCOPe 2.01: Domain d1tf2a4: 1tf2 A:396-570

Lineage for d1tf2a4 (1tf2 A:396-570)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (2 species)
   a pre-protein crosslinking domain inserted in the first AAA domain

7. Species Bacillus subtilis [TaxId:1423] [82415] (4 PDB entries)
   Uniprot P28366

8. Domain d1tf2a4: 1tf2 A:396-570 [106833]
   Other proteins in same PDB: d1tf2a1, d1tf2a2
   complexed with adp, mg

Details for d1tf2a4

PDB Entry: 1tf2, 2.9 Å

PDB Description: Crystal structure of SecA:ADP in an open conformation from Bacillus Subtilis

PDB Compounds: (A:) Preprotein translocase secA subunit

SCOPe Domain Sequences for d1tf2a4:

Sequence; same for both SEQRES and ATOM records:

>d1tf2a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}
rpvvrddrpdliyrtmegkfkavaedvaqrymtgqpvlvgtvavetseliskllknkgip
hqvlnaknhereaqiieeagqkgavtiatnmagrgtdiklgegvkelgglavvgterhes
rridnqlrgrsgrqgdpgitqfylsmedelmrrfgaertmamldrfgmddstpiq

Timeline for d1tf2a4:

• d1tf2a4 first appeared in SCOP 1.69
  
• d1tf2a4 appears in SCOP 1.75
  
• d1tf2a4 appears in SCOPe 2.02
  
• d1tf2a4 appears in the current release, SCOPe 2.08