![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins) Pfam PF01614 |
![]() | Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111114] (1 PDB entry) Uniprot P77734 97-269 |
![]() | Domain d1tf1b1: 1tf1 B:12-183 [106827] Other proteins in same PDB: d1tf1a2, d1tf1b2, d1tf1c2, d1tf1d2 Structural genomics target |
PDB Entry: 1tf1 (more details), 1.8 Å
SCOPe Domain Sequences for d1tf1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf1b1 d.110.2.2 (B:12-183) Transcriptional regulator AllR, C-terminal domain {Escherichia coli [TaxId: 562]} dvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrlplhasga gkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdkeehvvgln ciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk
Timeline for d1tf1b1: