Lineage for d1te6a2 (1te6 A:1-139)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649015Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1649060Protein Enolase [54828] (9 species)
  7. 1649104Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (9 PDB entries)
    Uniprot P09104
  8. 1649117Domain d1te6a2: 1te6 A:1-139 [106798]
    Other proteins in same PDB: d1te6a1, d1te6b1
    complexed with cl, mg, po4, trs

Details for d1te6a2

PDB Entry: 1te6 (more details), 1.8 Å

PDB Description: crystal structure of human neuron specific enolase at 1.8 angstrom
PDB Compounds: (A:) Gamma enolase

SCOPe Domain Sequences for d1te6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te6a2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d1te6a2:

Click to download the PDB-style file with coordinates for d1te6a2.
(The format of our PDB-style files is described here.)

Timeline for d1te6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1te6a1