Lineage for d1tdqb_ (1tdq B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226322Protein Aggrecan core protein [111260] (1 species)
  7. 1226323Species Norway rat (Rattus norvegicus) [TaxId:10116] [111261] (1 PDB entry)
    Uniprot P07897 1912-2037
  8. 1226324Domain d1tdqb_: 1tdq B: [106785]
    Other proteins in same PDB: d1tdqa1, d1tdqa2, d1tdqa3
    complexed with ca

Details for d1tdqb_

PDB Entry: 1tdq (more details), 2.6 Å

PDB Description: structural basis for the interactions between tenascins and the c-type lectin domains from lecticans: evidence for a cross-linking role for tenascins
PDB Compounds: (B:) Aggrecan core protein

SCOPe Domain Sequences for d1tdqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eqceegwtkfqghcyrhfpdretwvdaerrcreqqshlssivtpeeqefvnknaqdyqwi
glndrtiegdfrwsdghslqfekwrpnqpdnffatgedcvvmiwhergewndvpcnyqlp
ftckkg

SCOPe Domain Coordinates for d1tdqb_:

Click to download the PDB-style file with coordinates for d1tdqb_.
(The format of our PDB-style files is described here.)

Timeline for d1tdqb_: