Lineage for d1t9sa_ (1t9s A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508381Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1508571Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. 1508572Species Human (Homo sapiens) [TaxId:9606] [101440] (18 PDB entries)
    Uniprot O76074 534-860
  8. 1508581Domain d1t9sa_: 1t9s A: [106726]
    complexed with 5gp, mg, zn

Details for d1t9sa_

PDB Entry: 1t9s (more details), 2 Å

PDB Description: catalytic domain of human phosphodiesterase 5a in complex with gmp
PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d1t9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9sa_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
lkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpw
piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
thvsedcfplldgcrknrqkwqalae

SCOPe Domain Coordinates for d1t9sa_:

Click to download the PDB-style file with coordinates for d1t9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1t9sa_: