Lineage for d1t8ub_ (1t8u B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484015Family c.37.1.5: PAPS sulfotransferase [52575] (12 proteins)
    Pfam 00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 484045Protein Heparan sulfate glucosamine 3-O-sulfotransferase 3 [110532] (1 species)
  7. 484046Species Human (Homo sapiens) [TaxId:9606] [110533] (2 PDB entries)
  8. 484050Domain d1t8ub_: 1t8u B: [106688]

Details for d1t8ub_

PDB Entry: 1t8u (more details), 1.95 Å

PDB Description: crystal structure of human 3-o-sulfotransferase-3 with bound pap and tetrasaccharide substrate

SCOP Domain Sequences for d1t8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8ub_ c.37.1.5 (B:) Heparan sulfate glucosamine 3-O-sulfotransferase 3 {Human (Homo sapiens)}
pnsgtlallldegskqlpqaiiigvkkggtralleflrvhpdvravgaephffdrsydkg
lawyrdlmprtldgqitmektpsyfvtreaparisamskdtklivvvrdpvtraisdytq
tlskrpdiptfesltfknrtaglidtswsaiqigiyakhlehwlrhfpirqmlfvsgerl
isdpagelgrvqdflglkriitdkhfyfnktkgfpclkkaegssrphclgktkgrthpei
drevvrrlrefyrpfnlkfyqmtghdfgwdg

SCOP Domain Coordinates for d1t8ub_:

Click to download the PDB-style file with coordinates for d1t8ub_.
(The format of our PDB-style files is described here.)

Timeline for d1t8ub_: