Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) |
Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins) automatically mapped to Pfam PF01687 |
Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species) |
Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries) Uniprot Q9WZW1 TM0379 |
Domain d1t6ya1: 1t6y A:159-288 [106604] Other proteins in same PDB: d1t6ya2, d1t6yb2 complexed with adp, amp, fmn |
PDB Entry: 1t6y (more details), 2.8 Å
SCOPe Domain Sequences for d1t6ya1:
Sequence, based on SEQRES records: (download)
>d1t6ya1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar nmiddiinsk
>d1t6ya1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} yfeiegivhkfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrrnvkyevy ildfegdlygqrlklevlkfmrdekkeelkaaidqdvksarnmiddiinsk
Timeline for d1t6ya1: