Lineage for d1t6ya1 (1t6y A:159-288)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403385Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 2403386Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)
    automatically mapped to Pfam PF01687
  6. 2403402Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)
  7. 2403403Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries)
    Uniprot Q9WZW1
    TM0379
  8. 2403414Domain d1t6ya1: 1t6y A:159-288 [106604]
    Other proteins in same PDB: d1t6ya2, d1t6yb2
    complexed with adp, amp, fmn

Details for d1t6ya1

PDB Entry: 1t6y (more details), 2.8 Å

PDB Description: Crystal structure of ADP, AMP, and FMN bound TM379
PDB Compounds: (A:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d1t6ya1:

Sequence, based on SEQRES records: (download)

>d1t6ya1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinsk

Sequence, based on observed residues (ATOM records): (download)

>d1t6ya1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrrnvkyevy
ildfegdlygqrlklevlkfmrdekkeelkaaidqdvksarnmiddiinsk

SCOPe Domain Coordinates for d1t6ya1:

Click to download the PDB-style file with coordinates for d1t6ya1.
(The format of our PDB-style files is described here.)

Timeline for d1t6ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6ya2