SCOPe 2.07: Domain d1t66h1: 1t66 H:1-118

Lineage for d1t66h1 (1t66 H:1-118)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d1t66h1: 1t66 H:1-118 [106549]
   Other proteins in same PDB: d1t66c1, d1t66c2, d1t66d2, d1t66h2, d1t66l1, d1t66l2
   complexed with flu

Details for d1t66h1

PDB Entry: 1t66, 2.3 Å

PDB Description: The structure of FAB with intermediate affinity for fluorescein.

PDB Compounds: (H:) immunoglobulin heavy chain

SCOPe Domain Sequences for d1t66h1:

Sequence; same for both SEQRES and ATOM records:

>d1t66h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddskssvylqmnnlraedmgiyyctsygyhgaywgqgtlvtvsa

Timeline for d1t66h1:

• d1t66h1 first appeared in SCOP 1.69
  
• d1t66h1 appears in SCOPe 2.06
  
• d1t66h1 appears in the current release, SCOPe 2.08