SCOPe 2.02: Domain d1t60v2: 1t60 V:115-225

Lineage for d1t60v2 (1t60 V:115-225)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein)
   duplication: consists of two subdomains of this fold; segment swapping within and between individual domains

6. Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries)
   Uniprot P02462 1445-1667

8. Domain d1t60v2: 1t60 V:115-225 [106526]
   complexed with cl, k, mpd

Details for d1t60v2

PDB Entry: 1t60, 1.5 Å

PDB Description: Crystal structure of Type IV collagen NC1 domain from bovine lens capsule

PDB Compounds: (V:) type iv collagen

SCOPe Domain Sequences for d1t60v2:

Sequence; same for both SEQRES and ATOM records:

>d1t60v2 d.169.1.6 (V:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}
amvmavhsqtiqipqcptgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfi
echgrgtcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvc

Timeline for d1t60v2:

• d1t60v2 first appeared in SCOP 1.69
  
• d1t60v2 appears in SCOPe 2.01
  
• d1t60v2 appears in SCOPe 2.03
  
• d1t60v2 appears in the current release, SCOPe 2.08