| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
| Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins) |
| Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [50229] (11 PDB entries) Uniprot P23313 |
| Domain d1t5xd1: 1t5x D:1-121 [106493] Other proteins in same PDB: d1t5xa1, d1t5xa2, d1t5xb1, d1t5xb2, d1t5xd2 mutant |
PDB Entry: 1t5x (more details), 2.5 Å
SCOP Domain Sequences for d1t5xd1:
Sequence, based on SEQRES records: (download)
>d1t5xd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n
>d1t5xd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegn
Timeline for d1t5xd1:
View in 3DDomains from other chains: (mouse over for more information) d1t5xa1, d1t5xa2, d1t5xb1, d1t5xb2 |