Lineage for d1t5xd2 (1t5x D:122-239)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854470Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 854471Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 854520Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 854521Species Staphylococcus aureus [TaxId:1280] [54345] (11 PDB entries)
    Uniprot P23313
  8. 854529Domain d1t5xd2: 1t5x D:122-239 [106494]
    Other proteins in same PDB: d1t5xa1, d1t5xa2, d1t5xb1, d1t5xb2, d1t5xd1
    mutant

Details for d1t5xd2

PDB Entry: 1t5x (more details), 2.5 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
PDB Compounds: (D:) Enterotoxin type C-3

SCOP Domain Sequences for d1t5xd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5xd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOP Domain Coordinates for d1t5xd2:

Click to download the PDB-style file with coordinates for d1t5xd2.
(The format of our PDB-style files is described here.)

Timeline for d1t5xd2: