SCOPe 2.05: Domain d1t5ta4: 1t5t A:1-124,A:240-343,A:751-994

Lineage for d1t5ta4 (1t5t A:1-124,A:240-343,A:751-994)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
   core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains

4. Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family)

5. Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)

6. Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
   the N-terminal 40 residues interact with /form a part of transduction domain A

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (40 PDB entries)
   Uniprot P04191

8. Domain d1t5ta4: 1t5t A:1-124,A:240-343,A:751-994 [106480]
   Other proteins in same PDB: d1t5ta1, d1t5ta2, d1t5ta3
   complexed with adp, alf, ca, k, mg

Details for d1t5ta4

PDB Entry: 1t5t, 2.9 Å

PDB Description: Structure of the (SR)Ca2+-ATPase Ca2-E1-ADP:AlF4- form

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform SERCA1A

SCOPe Domain Sequences for d1t5ta4:

Sequence; same for both SEQRES and ATOM records:

>d1t5ta4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

Timeline for d1t5ta4:

• d1t5ta4 first appeared in SCOP 1.69
  
• d1t5ta4 appears in SCOPe 2.04
  
• d1t5ta4 appears in SCOPe 2.06
  
• d1t5ta4 appears in the current release, SCOPe 2.08