Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) |
Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins) |
Protein Calcium ATPase, transmembrane domain M [81663] (1 species) the N-terminal 40 residues interact with /form a part of transduction domain A |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (42 PDB entries) Uniprot P04191 |
Domain d1t5ta4: 1t5t A:1-124,A:240-343,A:751-994 [106480] Other proteins in same PDB: d1t5ta1, d1t5ta2, d1t5ta3 complexed with adp, alf, ca, k, mg |
PDB Entry: 1t5t (more details), 2.9 Å
SCOPe Domain Sequences for d1t5ta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5ta4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg
Timeline for d1t5ta4: