SCOPe 2.08: Domain d1t3nb1: 1t3n B:720-834

Lineage for d1t3nb1 (1t3n B:720-834)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DNA polymerase iota [111015] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries)
   Uniprot Q9UNA4

8. Domain d1t3nb1: 1t3n B:720-834 [106365]
   Other proteins in same PDB: d1t3na2, d1t3nb2
   protein/DNA complex; complexed with mg, ttp

Details for d1t3nb1

PDB Entry: 1t3n, 2.3 Å

PDB Description: structure of the catalytic core of dna polymerase iota in complex with dna and dttp

PDB Compounds: (B:) polymerase (DNA directed) iota

SCOPe Domain Sequences for d1t3nb1:

Sequence; same for both SEQRES and ATOM records:

>d1t3nb1 d.240.1.1 (B:720-834) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Timeline for d1t3nb1:

• d1t3nb1 first appeared in SCOP 1.69
  
• d1t3nb1 appears in SCOPe 2.07