Lineage for d1t3nb1 (1t3n B:720-834)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516579Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 516580Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 516581Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 516610Protein DNA polymerase iota [111015] (1 species)
  7. 516611Species Human (Homo sapiens) [TaxId:9606] [111016] (1 PDB entry)
  8. 516613Domain d1t3nb1: 1t3n B:720-834 [106365]
    Other proteins in same PDB: d1t3na2, d1t3nb2

Details for d1t3nb1

PDB Entry: 1t3n (more details), 2.3 Å

PDB Description: structure of the catalytic core of dna polymerase iota in complex with dna and dttp

SCOP Domain Sequences for d1t3nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3nb1 d.240.1.1 (B:720-834) DNA polymerase iota {Human (Homo sapiens)}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

SCOP Domain Coordinates for d1t3nb1:

Click to download the PDB-style file with coordinates for d1t3nb1.
(The format of our PDB-style files is described here.)

Timeline for d1t3nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3nb2