Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins) this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain |
Protein Serine acetyltransferase [110310] (2 species) extra N-terminal all-alpha subdomain belongs to Pfam PF06426 |
Species Escherichia coli [TaxId:562] [110312] (1 PDB entry) Uniprot P05796 |
Domain d1t3da_: 1t3d A: [106345] complexed with cys |
PDB Entry: 1t3d (more details), 2.2 Å
SCOPe Domain Sequences for d1t3da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3da_ b.81.1.6 (A:) Serine acetyltransferase {Escherichia coli [TaxId: 562]} msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp arivgkpdsdkpsmdmdqhfng
Timeline for d1t3da_: