PDB entry 1t3d

View 1t3d on RCSB PDB site
Description: Crystal structure of Serine Acetyltransferase from E.coli at 2.2A
Class: transferase
Keywords: left-handed-beta-helix, dimer of trimers, TRANSFERASE
Deposited on 2004-04-26, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17500000000000004
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CYSE, B3607, C4429, Z5034, ECS4485, SF3646, S4122
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9D4 (16-End)
      • modified residue (16)
      • modified residue (41)
      • modified residue (63)
      • modified residue (73)
      • modified residue (92)
      • modified residue (170)
      • modified residue (216)
      • modified residue (269)
      • modified residue (271)
    Domains in SCOPe 2.08: d1t3da_
  • Chain 'B':
    Compound: Serine acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CYSE, B3607, C4429, Z5034, ECS4485, SF3646, S4122
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9D4 (16-End)
      • modified residue (16)
      • modified residue (41)
      • modified residue (63)
      • modified residue (73)
      • modified residue (92)
      • modified residue (170)
      • modified residue (216)
      • modified residue (269)
      • modified residue (271)
    Domains in SCOPe 2.08: d1t3db_
  • Chain 'C':
    Compound: Serine acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CYSE, B3607, C4429, Z5034, ECS4485, SF3646, S4122
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9D4 (16-End)
      • modified residue (16)
      • modified residue (41)
      • modified residue (63)
      • modified residue (73)
      • modified residue (92)
      • modified residue (170)
      • modified residue (216)
      • modified residue (269)
      • modified residue (271)
    Domains in SCOPe 2.08: d1t3dc_
  • Heterogens: CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3dA (A:)
    hhhhhhssglvprgshmsceeleivwnnikaeartladcepmlasfyhatllkhenlgsa
    lsymlanklsspimpaiairevveeayaadpemiasaacdiqavrtrdpavdkystplly
    lkgfhalqayrighwlwnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivv
    getaviendvsilqsvtlggtgksggdrhpkiregvmigagakilgnievgrgakigags
    vvlqpvpphttaagvparivgkpdsdkpsmdmdqhfnginhtfeygdgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3dA (A:)
    msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa
    iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl
    wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv
    tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp
    arivgkpdsdkpsmdmdqhfng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3dB (B:)
    hhhhhhssglvprgshmsceeleivwnnikaeartladcepmlasfyhatllkhenlgsa
    lsymlanklsspimpaiairevveeayaadpemiasaacdiqavrtrdpavdkystplly
    lkgfhalqayrighwlwnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivv
    getaviendvsilqsvtlggtgksggdrhpkiregvmigagakilgnievgrgakigags
    vvlqpvpphttaagvparivgkpdsdkpsmdmdqhfnginhtfeygdgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3dB (B:)
    msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa
    iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl
    wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv
    tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp
    arivgkpdsdkpsmdmdqhfng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t3dC (C:)
    hhhhhhssglvprgshmsceeleivwnnikaeartladcepmlasfyhatllkhenlgsa
    lsymlanklsspimpaiairevveeayaadpemiasaacdiqavrtrdpavdkystplly
    lkgfhalqayrighwlwnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivv
    getaviendvsilqsvtlggtgksggdrhpkiregvmigagakilgnievgrgakigags
    vvlqpvpphttaagvparivgkpdsdkpsmdmdqhfnginhtfeygdgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3dC (C:)
    msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa
    iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl
    wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv
    tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp
    arivgkpdsdkpsmdmdqhfng