Lineage for d1t36e4 (1t36 E:556-676)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360440Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1360441Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1360442Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1360495Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 1360496Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
    Uniprot P00968
  8. 1360534Domain d1t36e4: 1t36 E:556-676 [106320]
    Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a5, d1t36a6, d1t36b1, d1t36b2, d1t36c1, d1t36c2, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e1, d1t36e2, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36g1, d1t36g2, d1t36g5, d1t36g6, d1t36h1, d1t36h2
    complexed with adp, cl, k, mn, net, orn, po4, u; mutant

Details for d1t36e4

PDB Entry: 1t36 (more details), 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate
PDB Compounds: (E:) Carbamoyl-phosphate synthase large chain

SCOPe Domain Sequences for d1t36e4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t36e4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOPe Domain Coordinates for d1t36e4:

Click to download the PDB-style file with coordinates for d1t36e4.
(The format of our PDB-style files is described here.)

Timeline for d1t36e4: