![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) ![]() |
![]() | Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins) |
![]() | Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species) duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains |
![]() | Species Escherichia coli [TaxId:562] [56077] (10 PDB entries) Uniprot P00968 |
![]() | Domain d1t36a6: 1t36 A:677-935 [106306] Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36b1, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36d1, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36f1, d1t36f2, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36h1, d1t36h2 complexed with adp, cl, k, mn, net, orn, po4, u; mutant |
PDB Entry: 1t36 (more details), 2.1 Å
SCOPe Domain Sequences for d1t36a6:
Sequence, based on SEQRES records: (download)
>d1t36a6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge vmgvgrtfaeafakaqlgs
>d1t36a6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} rfqhaverlklkqpanatvtaiemavekakeigyplvvrpameivydeadlrryfqtavl ldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmrq qvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvmag kslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafaka qlgs
Timeline for d1t36a6:
![]() Domains from other chains: (mouse over for more information) d1t36b1, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h1, d1t36h2 |