Lineage for d1t2oc_ (1t2o C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1562506Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 1562507Superfamily b.100.1: Sortase [63817] (1 family) (S)
  5. 1562508Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 1562514Protein Sortase A [63819] (1 species)
  7. 1562515Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries)
    Uniprot Q9S446 61-206
  8. 1562524Domain d1t2oc_: 1t2o C: [106282]

Details for d1t2oc_

PDB Entry: 1t2o (more details), 2.3 Å

PDB Description: crystal structure of se-srta, c184-ala
PDB Compounds: (C:) Sortase

SCOPe Domain Sequences for d1t2oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2oc_ b.100.1.1 (C:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
pqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaghtf
idrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltli
taddynektgvwekrkifvatevk

SCOPe Domain Coordinates for d1t2oc_:

Click to download the PDB-style file with coordinates for d1t2oc_.
(The format of our PDB-style files is described here.)

Timeline for d1t2oc_: