Lineage for d1t1rb4 (1t1r B:126-274)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1210563Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1210564Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1210911Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 1210912Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. 1210913Species Escherichia coli [TaxId:562] [69771] (11 PDB entries)
    Uniprot P45568
  8. 1210922Domain d1t1rb4: 1t1r B:126-274 [106269]
    Other proteins in same PDB: d1t1ra1, d1t1ra2, d1t1ra3, d1t1rb1, d1t1rb2, d1t1rb3
    complexed with imb, so4

Details for d1t1rb4

PDB Entry: 1t1r (more details), 2.3 Å

PDB Description: Crystal Structure of the Reductoisomerase Complexed with a Bisphosphonate
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1t1rb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1rb4 d.81.1.3 (B:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
slvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltgs
ggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasqm
evlihpqsvihsmvryqdgsvlaqlgepd

SCOPe Domain Coordinates for d1t1rb4:

Click to download the PDB-style file with coordinates for d1t1rb4.
(The format of our PDB-style files is described here.)

Timeline for d1t1rb4: