Lineage for d1t1ha_ (1t1h A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625077Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 625078Superfamily g.44.1: RING/U-box [57850] (3 families) (S)
  5. 625125Family g.44.1.2: U-box [90222] (3 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 625126Protein E3 ubiquitin ligase PUB14 [111461] (1 species)
    Armadillo repeat containing protein
  7. 625127Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [111462] (1 PDB entry)
  8. 625128Domain d1t1ha_: 1t1h A: [106247]

Details for d1t1ha_

PDB Entry: 1t1h (more details)

PDB Description: nmr solution structure of the u box domain from atpub14, an armadillo repeat containing protein from arabidopsis thaliana

SCOP Domain Sequences for d1t1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana)}
gspefpeyfrcpislelmkdpvivstgqtyerssiqkwldaghktcpksqetllhagltp
nyvlkslialwcesngie

SCOP Domain Coordinates for d1t1ha_:

Click to download the PDB-style file with coordinates for d1t1ha_.
(The format of our PDB-style files is described here.)

Timeline for d1t1ha_: