SCOP 1.69: Domain d1t1ha_: 1t1h A:

Lineage for d1t1ha_ (1t1h A:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (2 families)

5. Family g.44.1.2: U-box [90222] (2 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein E3 ubiquitin ligase PUB14 [111461] (1 species)
   Armadillo repeat containing protein

7. Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [111462] (1 PDB entry)

8. Domain d1t1ha_: 1t1h A: [106247]

Details for d1t1ha_

PDB Entry: 1t1h

PDB Description: nmr solution structure of the u box domain from atpub14, an armadillo repeat containing protein from arabidopsis thaliana

SCOP Domain Sequences for d1t1ha_:

Sequence; same for both SEQRES and ATOM records:

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana)}
gspefpeyfrcpislelmkdpvivstgqtyerssiqkwldaghktcpksqetllhagltp
nyvlkslialwcesngie

Timeline for d1t1ha_:

• d1t1ha_ is new in SCOP 1.69
  
• d1t1ha_ appears in SCOP 1.71
  
• d1t1ha_ appears in the current release, SCOPe 2.08, called d1t1ha1