Lineage for d1t11b3 (1t11 B:135-247)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857508Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 857509Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 857662Protein Trigger factor PPIase domain [75388] (3 species)
  7. 857670Species Vibrio cholerae [TaxId:666] [110869] (1 PDB entry)
    Uniprot Q9KQS5
  8. 857672Domain d1t11b3: 1t11 B:135-247 [106241]
    Other proteins in same PDB: d1t11a1, d1t11a2, d1t11b1, d1t11b2

Details for d1t11b3

PDB Entry: 1t11 (more details), 2.5 Å

PDB Description: trigger factor
PDB Compounds: (B:) Trigger Factor

SCOP Domain Sequences for d1t11b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t11b3 d.26.1.1 (B:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]}
advaemletlrkqqatwkevdeaaengkrvsidfvgsidgvefeggkaenfplemgagrm
ipgfedgivgktkgmefvidvtfpedyhaenlkgkaakfaikvnkvearelpe

SCOP Domain Coordinates for d1t11b3:

Click to download the PDB-style file with coordinates for d1t11b3.
(The format of our PDB-style files is described here.)

Timeline for d1t11b3: