Lineage for d1t11b3 (1t11 B:135-247)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. Protein Trigger factor PPIase domain [75388] (3 species)
  7. Species Vibrio cholerae [TaxId:666] [110869] (1 PDB entry)
    Uniprot Q9KQS5
  8. Domain d1t11b3: 1t11 B:135-247 [106241]
    Other proteins in same PDB: d1t11a1, d1t11a2, d1t11a4, d1t11b1, d1t11b2, d1t11b4
    has additional insertions and/or extensions that are not grouped together

Details for d1t11b3

PDB Entry: 1t11 (more details), 2.5 Å

PDB Description: trigger factor
PDB Compounds: (B:) Trigger Factor

SCOPe Domain Sequences for d1t11b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t11b3 d.26.1.1 (B:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]}
advaemletlrkqqatwkevdeaaengkrvsidfvgsidgvefeggkaenfplemgagrm
ipgfedgivgktkgmefvidvtfpedyhaenlkgkaakfaikvnkvearelpe

SCOPe Domain Coordinates for d1t11b3 are not available.

Timeline for d1t11b3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t11b1, d1t11b2, d1t11b4
View in 3D
Domains from other chains:
(mouse over for more information)
d1t11a1, d1t11a2, d1t11a3, d1t11a4