Lineage for d1t0tw_ (1t0t W:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026927Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1027070Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins)
    Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer
  6. 1027078Protein YwfI homologue [110966] (1 species)
  7. 1027079Species Bacillus stearothermophilus [TaxId:1422] [110967] (1 PDB entry)
    Uniprot Q5KUD5 # 98% sequence identity; Geobacillus kaustophilus TaxID:1462
  8. 1027081Domain d1t0tw_: 1t0t W: [106230]
    complexed with mg, p33

Details for d1t0tw_

PDB Entry: 1t0t (more details), 1.75 Å

PDB Description: crystallographic structure of a putative chlorite dismutase
PDB Compounds: (W:) apc35880

SCOPe Domain Sequences for d1t0tw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0tw_ d.58.4.10 (W:) YwfI homologue {Bacillus stearothermophilus [TaxId: 1422]}
qtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavytivg
qkadilfmilrptldelheietalnktkladyllpaysyvsvvelsnylasgsedpyqip
evrrrlypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagkvtqi
itgsvglddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmenvssf
fhv

SCOPe Domain Coordinates for d1t0tw_:

Click to download the PDB-style file with coordinates for d1t0tw_.
(The format of our PDB-style files is described here.)

Timeline for d1t0tw_: