Lineage for d1t01a2 (1t01 A:126-252)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 910207Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 910208Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 910224Protein Vinculin [47224] (2 species)
  7. 910225Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
    Uniprot P12003
  8. 910229Domain d1t01a2: 1t01 A:126-252 [106189]
    complexed with Talin 1 fragment (Uniprot P26039 605-628), chain B

Details for d1t01a2

PDB Entry: 1t01 (more details), 2.06 Å

PDB Description: Vinculin complexed with the VBS1 helix from talin
PDB Compounds: (A:) unnamed protein product

SCOPe Domain Sequences for d1t01a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t01a2 a.24.9.1 (A:126-252) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
fdeaevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthq
ehrvmlvnsmntvkellpvlisamkifvttkntksqgieealknrnftvekmsaeineii
rvlqlts

SCOPe Domain Coordinates for d1t01a2:

Click to download the PDB-style file with coordinates for d1t01a2.
(The format of our PDB-style files is described here.)

Timeline for d1t01a2: