SCOPe 2.03: Domain d1sxjh2: 1sxj H:127-254

Lineage for d1sxjh2 (1sxj H:127-254)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (5 PDB entries)
   Uniprot P15873

8. Domain d1sxjh2: 1sxj H:127-254 [106096]
   Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2
   complexed with adp, ags, mg

Details for d1sxjh2

PDB Entry: 1sxj, 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)

PDB Compounds: (H:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1sxjh2:

Sequence; same for both SEQRES and ATOM records:

>d1sxjh2 d.131.1.2 (H:127-254) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkf

Timeline for d1sxjh2:

• d1sxjh2 first appeared in SCOP 1.69
  
• d1sxjh2 appears in SCOPe 2.02
  
• d1sxjh2 appears in SCOPe 2.04
  
• d1sxjh2 appears in the current release, SCOPe 2.08