| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
| Protein Replication factor C2 [110572] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110573] (1 PDB entry) Uniprot P40348 |
| Domain d1sxjd2: 1sxj D:26-262 [106088] Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2 complexed with adp, ags, mg |
PDB Entry: 1sxj (more details), 2.85 Å
SCOPe Domain Sequences for d1sxjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pwvekyrpknldevtaqdhavtvlkktlksanlphmlfygppgtgktstilaltkelygp
dlmksrilelnasdergisivrekvknfarltvskpskhdlenypcppykiiildeadsm
tadaqsalrrtmetysgvtrfclicnyvtriidplasqcskfrfkaldasnaidrlrfis
eqenvkcddgvlerildisagdlrrgitllqsaskgaqylgdgknitstqveelagv
Timeline for d1sxjd2: