Lineage for d1sxjf1 (1sxj F:1-126)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669824Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1669825Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1670010Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 1670032Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species)
  7. 1670040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (6 PDB entries)
    Uniprot P15873
  8. 1670055Domain d1sxjf1: 1sxj F:1-126 [106091]
    Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2
    complexed with adp, ags, mg

Details for d1sxjf1

PDB Entry: 1sxj (more details), 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
PDB Compounds: (F:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1sxjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxjf1 d.131.1.2 (F:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

SCOPe Domain Coordinates for d1sxjf1:

Click to download the PDB-style file with coordinates for d1sxjf1.
(The format of our PDB-style files is described here.)

Timeline for d1sxjf1: