| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (6 PDB entries) Uniprot P15873 |
| Domain d1sxjf1: 1sxj F:1-126 [106091] Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2 complexed with adp, ags, mg |
PDB Entry: 1sxj (more details), 2.85 Å
SCOPe Domain Sequences for d1sxjf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxjf1 d.131.1.2 (F:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl
Timeline for d1sxjf1: