SCOP 1.71: Domain d1sxjd1: 1sxj D:263-353

Lineage for d1sxjd1 (1sxj D:263-353)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein Replication factor C2 [109900] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109901] (1 PDB entry)

8. Domain d1sxjd1: 1sxj D:263-353 [106087]
   Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2
   complexed with adp, atg, mg; mutant

Details for d1sxjd1

PDB Entry: 1sxj, 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)

SCOP Domain Sequences for d1sxjd1:

Sequence; same for both SEQRES and ATOM records:

>d1sxjd1 a.80.1.1 (D:263-353) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae)}
vphdilieivekvksgdfdeikkyvntfmksgwsaasvvnqlheyyitndnfdtnfknqi
swllfttdsrlnngtnehiqllnllvkisql

Timeline for d1sxjd1:

• d1sxjd1 first appeared in SCOP 1.69
  
• d1sxjd1 appears in SCOP 1.73
  
• d1sxjd1 appears in the current release, SCOPe 2.08