Lineage for d1sxjb1 (1sxj B:230-322)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540726Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 540727Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 540728Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 540780Protein Replication factor C4 [109896] (1 species)
  7. 540781Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109897] (1 PDB entry)
  8. 540782Domain d1sxjb1: 1sxj B:230-322 [106083]
    Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2
    complexed with adp, atg, mg; mutant

Details for d1sxjb1

PDB Entry: 1sxj (more details), 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)

SCOP Domain Sequences for d1sxjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxjb1 a.80.1.1 (B:230-322) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae)}
sphplivkkmllasnledsiqilrtdlwkkgyssidivttsfrvtknlaqvkesvrlemi
keiglthmrilegvgtylqlasmlakihklnnk

SCOP Domain Coordinates for d1sxjb1:

Click to download the PDB-style file with coordinates for d1sxjb1.
(The format of our PDB-style files is described here.)

Timeline for d1sxjb1: