| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) ![]() associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
| Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
| Protein Replication factor C4 [109896] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109897] (1 PDB entry) |
| Domain d1sxjb1: 1sxj B:230-322 [106083] Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2 complexed with adp, atg, mg; mutant |
PDB Entry: 1sxj (more details), 2.85 Å
SCOP Domain Sequences for d1sxjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxjb1 a.80.1.1 (B:230-322) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae)}
sphplivkkmllasnledsiqilrtdlwkkgyssidivttsfrvtknlaqvkesvrlemi
keiglthmrilegvgtylqlasmlakihklnnk
Timeline for d1sxjb1: