SCOPe 2.02: Domain d1sxjc1: 1sxj C:239-333

Lineage for d1sxjc1 (1sxj C:239-333)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein Replication factor C3 [109898] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109899] (1 PDB entry)
   Uniprot P38629

8. Domain d1sxjc1: 1sxj C:239-333 [106085]
   Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjg1, d1sxjg2, d1sxjh1, d1sxjh2
   complexed with adp, ags, mg

Details for d1sxjc1

PDB Entry: 1sxj, 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)

PDB Compounds: (C:) Activator 1 40 kDa subunit

SCOPe Domain Sequences for d1sxjc1:

Sequence; same for both SEQRES and ATOM records:

>d1sxjc1 a.80.1.1 (C:239-333) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
prpsdlkavlksileddwgtahytlnkvrsakglalidliegivkiledyelqneetrvh
lltkladieysiskggndqiqgsavigaikasfen

Timeline for d1sxjc1:

• d1sxjc1 first appeared in SCOP 1.69
  
• d1sxjc1 appears in SCOPe 2.01
  
• d1sxjc1 appears in SCOPe 2.03
  
• d1sxjc1 appears in the current release, SCOPe 2.08