Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) |
Family c.67.1.1: AAT-like [53384] (16 proteins) |
Protein Low-specificity threonine aldolase [64123] (2 species) |
Species Leishmania major [TaxId:5664] [110676] (1 PDB entry) Uniprot O15839 |
Domain d1svvb_: 1svv B: [106055] complexed with unl |
PDB Entry: 1svv (more details), 2.1 Å
SCOP Domain Sequences for d1svvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svvb_ c.67.1.1 (B:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn dfdmytveplkdgtcimrlctswateekechrfvevlkrlva
Timeline for d1svvb_: