Lineage for d1svvb_ (1svv B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490721Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 490722Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 490723Family c.67.1.1: AAT-like [53384] (10 proteins)
  6. 490954Protein Low-specificity threonine aldolase [64123] (2 species)
  7. 490955Species Leishmania major [TaxId:5664] [110676] (1 PDB entry)
  8. 490957Domain d1svvb_: 1svv B: [106055]

Details for d1svvb_

PDB Entry: 1svv (more details), 2.1 Å

PDB Description: initial stuctural analysis of leishmania major threonine aldolase

SCOP Domain Sequences for d1svvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svvb_ c.67.1.1 (B:) Low-specificity threonine aldolase {Leishmania major}
pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg
gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa
lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp
vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg
iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn
dfdmytveplkdgtcimrlctswateekechrfvevlkrlva

SCOP Domain Coordinates for d1svvb_:

Click to download the PDB-style file with coordinates for d1svvb_.
(The format of our PDB-style files is described here.)

Timeline for d1svvb_: