Lineage for d1sv4a_ (1sv4 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539306Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 539307Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 539308Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species)
  7. 539309Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries)
  8. 539312Domain d1sv4a_: 1sv4 A: [106041]

Details for d1sv4a_

PDB Entry: 1sv4 (more details), 2.15 Å

PDB Description: crystal structure of yan-sam

SCOP Domain Sequences for d1sv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv4a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster)}
qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
agdvlhnvlqmliieshs

SCOP Domain Coordinates for d1sv4a_:

Click to download the PDB-style file with coordinates for d1sv4a_.
(The format of our PDB-style files is described here.)

Timeline for d1sv4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sv4b_