Lineage for d1sv4a1 (1sv4 A:42-118)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries)
    Uniprot Q01842 42-118
  8. Domain d1sv4a1: 1sv4 A:42-118 [106041]
    Other proteins in same PDB: d1sv4a2, d1sv4b2

Details for d1sv4a1

PDB Entry: 1sv4 (more details), 2.15 Å

PDB Description: Crystal Structure of Yan-SAM
PDB Compounds: (A:) Ets DNA-binding protein pokkuri

SCOPe Domain Sequences for d1sv4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv4a1 a.60.1.1 (A:42-118) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
agdvlhnvlqmliiesh

SCOPe Domain Coordinates for d1sv4a1 are not available.

Timeline for d1sv4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sv4a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1sv4b1, d1sv4b2