Lineage for d1st6a8 (1st6 A:875-1065)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638081Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 638082Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 638098Protein Vinculin [47224] (2 species)
  7. 638099Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
  8. 638111Domain d1st6a8: 1st6 A:875-1065 [106007]
    full-length protein containing eight four-helix bundle domains

Details for d1st6a8

PDB Entry: 1st6 (more details), 3.1 Å

PDB Description: Crystal structure of a cytoskeletal protein
PDB Compounds: (A:) vinculin

SCOP Domain Sequences for d1st6a8:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st6a8 a.24.9.1 (A:875-1065) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
ppppeekdeefpeqkageainqpmmmaarqlhdearkwsskgndiiaaakrmallmaems
rlvrggsgnkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistq
lkilstvkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagf
tlrwvrktpwy

SCOP Domain Coordinates for d1st6a8:

Click to download the PDB-style file with coordinates for d1st6a8.
(The format of our PDB-style files is described here.)

Timeline for d1st6a8: