Class a: All alpha proteins [46456] (226 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) |
Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
Protein Vinculin [47224] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries) |
Domain d1st6a1: 1st6 A:1-125 [106000] |
PDB Entry: 1st6 (more details), 3.1 Å
SCOP Domain Sequences for d1st6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1st6a1 a.24.9.1 (A:1-125) Vinculin {Chicken (Gallus gallus)} mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvsavqaavsnlvrvgke tvqttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgts dlllt
Timeline for d1st6a1: