Lineage for d1st6a4 (1st6 A:372-488)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535641Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) (S)
  5. 535642Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 535658Protein Vinculin [47224] (2 species)
  7. 535659Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
  8. 535667Domain d1st6a4: 1st6 A:372-488 [106003]

Details for d1st6a4

PDB Entry: 1st6 (more details), 3.1 Å

PDB Description: Crystal structure of a cytoskeletal protein

SCOP Domain Sequences for d1st6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st6a4 a.24.9.1 (A:372-488) Vinculin {Chicken (Gallus gallus)}
rkleamtnskqaiakkidaaqnwladpnggsegeehirgimsearkvaelceepkerddi
lrslgeisaltaklsdlrrhgkgdspearalakqiatslqnlqsktnravantrpvk

SCOP Domain Coordinates for d1st6a4:

Click to download the PDB-style file with coordinates for d1st6a4.
(The format of our PDB-style files is described here.)

Timeline for d1st6a4: