Lineage for d1ss3a_ (1ss3 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257029Fold g.2: Toxic hairpin [57006] (4 superfamilies)
    disulfide crosslinked alpha-helical hairpin
  4. 2257040Superfamily g.2.3: Pollen allergen ole e 6 [111388] (1 family) (S)
    contains 3 disulfides
    automatically mapped to Pfam PF09253
  5. 2257041Family g.2.3.1: Pollen allergen ole e 6 [111389] (1 protein)
  6. 2257042Protein Pollen allergen ole e 6 [111390] (1 species)
  7. 2257043Species Common olive (Olea europaea) [TaxId:4146] [111391] (1 PDB entry)
    Uniprot O24172
  8. 2257044Domain d1ss3a_: 1ss3 A: [105975]

Details for d1ss3a_

PDB Entry: 1ss3 (more details)

PDB Description: solution structure of ole e 6, an allergen from olive tree pollen
PDB Compounds: (A:) Pollen allergen Ole e 6

SCOPe Domain Sequences for d1ss3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ss3a_ g.2.3.1 (A:) Pollen allergen ole e 6 {Common olive (Olea europaea) [TaxId: 4146]}
deaqfkecydtchkecsdkgngftfcemkcdtdcsvkdvkeklenykpkn

SCOPe Domain Coordinates for d1ss3a_:

Click to download the PDB-style file with coordinates for d1ss3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ss3a_: