Class g: Small proteins [56992] (94 folds) |
Fold g.2: Toxic hairpin [57006] (4 superfamilies) disulfide crosslinked alpha-helical hairpin |
Superfamily g.2.3: Pollen allergen ole e 6 [111388] (1 family) contains 3 disulfides automatically mapped to Pfam PF09253 |
Family g.2.3.1: Pollen allergen ole e 6 [111389] (1 protein) |
Protein Pollen allergen ole e 6 [111390] (1 species) |
Species Common olive (Olea europaea) [TaxId:4146] [111391] (1 PDB entry) Uniprot O24172 |
Domain d1ss3a_: 1ss3 A: [105975] |
PDB Entry: 1ss3 (more details)
SCOPe Domain Sequences for d1ss3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ss3a_ g.2.3.1 (A:) Pollen allergen ole e 6 {Common olive (Olea europaea) [TaxId: 4146]} deaqfkecydtchkecsdkgngftfcemkcdtdcsvkdvkeklenykpkn
Timeline for d1ss3a_: