SCOP 1.69: Domain d1sqja1: 1sqj A:4-430

Lineage for d1sqja1 (1sqj A:4-430)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (1 family)
   duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (scop_pr 89378)

5. Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (1 protein)
   contains at least 9 BNR/Asp-box repeats (Pfam 02012) usually associated with the 6-bladed propeller Neuraminidases (scop_sf 50939)

6. Protein Oligoxyloglucan reducing end-specific cellobiohydrolase [110298] (1 species)

7. Species Yeast (Geotrichum sp. M128) [TaxId:203496] [110299] (1 PDB entry)

8. Domain d1sqja1: 1sqj A:4-430 [105918]

Details for d1sqja1

PDB Entry: 1sqj, 2.2 Å

PDB Description: Crystal Structure Analysis of Oligoxyloglucan reducing-end-specific cellobiohydrolase (OXG-RCBH)

SCOP Domain Sequences for d1sqja1:

Sequence; same for both SEQRES and ATOM records:

>d1sqja1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128)}
yefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmni
mgtesialdpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnng
erlavnpfnsnevwmgtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngt
iyasatapqgmyvthdggvswepvagqpsswlnrttgafpdkkpasiapqpmkvaltpnf
lyvtyadypgpwgvtfgevwrqnrtsgawdditprvgnsspapynnqtfpaggfcglsvd
atnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlsspsnlegnwghptnaarykd
gtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygtgatiwatdt
lsrvekd

Timeline for d1sqja1:

• d1sqja1 is new in SCOP 1.69
  
• d1sqja1 appears in SCOP 1.71
  
• d1sqja1 appears in the current release, SCOPe 2.08