Lineage for d1sqjb1 (1sqj B:4-430)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469053Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 469282Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (1 family) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (scop_pr 89378)
  5. 469283Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (1 protein)
    contains at least 9 BNR/Asp-box repeats (Pfam 02012) usually associated with the 6-bladed propeller Neuraminidases (scop_sf 50939)
  6. 469284Protein Oligoxyloglucan reducing end-specific cellobiohydrolase [110298] (1 species)
  7. 469285Species Yeast (Geotrichum sp. M128) [TaxId:203496] [110299] (1 PDB entry)
  8. 469288Domain d1sqjb1: 1sqj B:4-430 [105920]

Details for d1sqjb1

PDB Entry: 1sqj (more details), 2.2 Å

PDB Description: Crystal Structure Analysis of Oligoxyloglucan reducing-end-specific cellobiohydrolase (OXG-RCBH)

SCOP Domain Sequences for d1sqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqjb1 b.69.13.1 (B:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128)}
yefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmni
mgtesialdpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnng
erlavnpfnsnevwmgtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngt
iyasatapqgmyvthdggvswepvagqpsswlnrttgafpdkkpasiapqpmkvaltpnf
lyvtyadypgpwgvtfgevwrqnrtsgawdditprvgnsspapynnqtfpaggfcglsvd
atnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlsspsnlegnwghptnaarykd
gtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygtgatiwatdt
lsrvekd

SCOP Domain Coordinates for d1sqjb1:

Click to download the PDB-style file with coordinates for d1sqjb1.
(The format of our PDB-style files is described here.)

Timeline for d1sqjb1:

Domains from same chain:
(mouse over for more information)
d1sqjb2
Domains from other chains:
(mouse over for more information)
d1sqja1, d1sqja2