![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (1 family) ![]() duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (scop_pr 89378) |
![]() | Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (1 protein) contains at least 9 BNR/Asp-box repeats (Pfam 02012) usually associated with the 6-bladed propeller Neuraminidases (scop_sf 50939) |
![]() | Protein Oligoxyloglucan reducing end-specific cellobiohydrolase [110298] (1 species) |
![]() | Species Yeast (Geotrichum sp. M128) [TaxId:203496] [110299] (1 PDB entry) |
![]() | Domain d1sqjb1: 1sqj B:4-430 [105920] |
PDB Entry: 1sqj (more details), 2.2 Å
SCOP Domain Sequences for d1sqjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqjb1 b.69.13.1 (B:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128)} yefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmni mgtesialdpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnng erlavnpfnsnevwmgtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngt iyasatapqgmyvthdggvswepvagqpsswlnrttgafpdkkpasiapqpmkvaltpnf lyvtyadypgpwgvtfgevwrqnrtsgawdditprvgnsspapynnqtfpaggfcglsvd atnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlsspsnlegnwghptnaarykd gtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygtgatiwatdt lsrvekd
Timeline for d1sqjb1: