Lineage for d1sqbi_ (1sqb I:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879358Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 879359Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 879374Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 879375Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 879376Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
    Uniprot P13272 1-57
    Uniprot P13272
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 879388Domain d1sqbi_: 1sqb I: [105903]
    Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbj_, d1sqbk_
    complexed with azo, fes, hem

Details for d1sqbi_

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin
PDB Compounds: (I:) ubiquinol-cytochrome c reductase 8 kda protein

SCOP Domain Sequences for d1sqbi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqbi_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOP Domain Coordinates for d1sqbi_:

Click to download the PDB-style file with coordinates for d1sqbi_.
(The format of our PDB-style files is described here.)

Timeline for d1sqbi_: