Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) |
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries) Uniprot P13272; precursor of chains I,E and V,R |
Domain d1sqbe2: 1sqb E:1-69 [105899] Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_ complexed with azo, fes, hem |
PDB Entry: 1sqb (more details), 2.69 Å
SCOP Domain Sequences for d1sqbe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqbe2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs smsasadvl
Timeline for d1sqbe2: