SCOP 1.69: Domain d1sq2n_: 1sq2 N:

Lineage for d1sq2n_ (1sq2 N:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Novel antigen receptor (against lysozyme) [110042] (1 species)

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (2 PDB entries)

8. Domain d1sq2n_: 1sq2 N: [105881]
   Other proteins in same PDB: d1sq2l_

Details for d1sq2n_

PDB Entry: 1sq2, 1.45 Å

PDB Description: Crystal Structure Analysis of the Nurse Shark New Antigen Receptor (NAR) Variable Domain in Complex With Lysozyme

SCOP Domain Sequences for d1sq2n_:

Sequence; same for both SEQRES and ATOM records:

>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum)}
rvdqtprsvtketgesltincvlrdasyalgstcwyrkksgegneesiskggryvetvns
gsksfslrindltvedggtyrcglgvaggycdyalcssryaecgdgtavtvn

Timeline for d1sq2n_:

• d1sq2n_ is new in SCOP 1.69
  
• d1sq2n_ appears in SCOP 1.71
  
• d1sq2n_ appears in the current release, SCOPe 2.08