Lineage for d1sozc2 (1soz C:42-254)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670184Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)
  6. 670305Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 670306Species Escherichia coli [TaxId:562] [110237] (4 PDB entries)
  8. 670312Domain d1sozc2: 1soz C:42-254 [105864]
    Other proteins in same PDB: d1soza1, d1sozb1, d1sozc1

Details for d1sozc2

PDB Entry: 1soz (more details), 2.4 Å

PDB Description: Crystal Structure of DegS protease in complex with an activating peptide
PDB Compounds: (C:) Protease degS

SCOP Domain Sequences for d1sozc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sozc2 b.47.1.1 (C:42-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
ksndgetpegigfaipfqlatkimdklirdgrv

SCOP Domain Coordinates for d1sozc2:

Click to download the PDB-style file with coordinates for d1sozc2.
(The format of our PDB-style files is described here.)

Timeline for d1sozc2: