SCOP 1.73: Domain d1sotb2: 1sot B:42-254

Lineage for d1sotb2 (1sot B:42-254)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)

6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)

7. Species Escherichia coli [TaxId:562] [110237] (4 PDB entries)

8. Domain d1sotb2: 1sot B:42-254 [105855]
   Other proteins in same PDB: d1sota1, d1sotb1, d1sotc1

Details for d1sotb2

PDB Entry: 1sot, 2.3 Å

PDB Description: Crystal Structure of the DegS stress sensor

PDB Compounds: (B:) Protease degS

SCOP Domain Sequences for d1sotb2:

Sequence, based on SEQRES records:

>d1sotb2 b.47.1.1 (B:42-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
ksndgetpegigfaipfqlatkimdklirdgrv

Sequence, based on observed residues (ATOM records):

>d1sotb2 b.47.1.1 (B:42-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
pegigfaipfqlatkimdklirdgrv

Timeline for d1sotb2:

• d1sotb2 first appeared in SCOP 1.69
  
• d1sotb2 appears in SCOP 1.71
  
• d1sotb2 appears in SCOP 1.75
  
• d1sotb2 appears in the current release, SCOPe 2.08