Lineage for d1sota1 (1sot A:255-353)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666870Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 666884Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)
  7. 666885Species Escherichia coli [TaxId:562] [110189] (4 PDB entries)
  8. 666886Domain d1sota1: 1sot A:255-353 [105852]
    Other proteins in same PDB: d1sota2, d1sotb2, d1sotc2

Details for d1sota1

PDB Entry: 1sot (more details), 2.3 Å

PDB Description: Crystal Structure of the DegS stress sensor
PDB Compounds: (A:) Protease degS

SCOP Domain Sequences for d1sota1:

Sequence, based on SEQRES records: (download)

>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeypa

Sequence, based on observed residues (ATOM records): (download)

>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggrgivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsv
ipvvvqltlqvtiqeypa

SCOP Domain Coordinates for d1sota1:

Click to download the PDB-style file with coordinates for d1sota1.
(The format of our PDB-style files is described here.)

Timeline for d1sota1: