![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.39: Fragments of apolipoproteins [58579] (1 superfamily) |
![]() | Superfamily j.39.1: Fragments of apolipoproteins [58580] (1 family) ![]() |
![]() | Family j.39.1.1: Fragments of apolipoproteins [58581] (1 protein) |
![]() | Protein Fragments of apolipoproteins [58582] (10 species) |
![]() | Species Human (Homo sapiens), synthetic, C-II [TaxId:9606] [58591] (4 PDB entries) Uniprot P02655 23-101 |
![]() | Domain d1soha_: 1soh A: [105845] structure in dodecyl phosphocholine |
PDB Entry: 1soh (more details)
SCOPe Domain Sequences for d1soha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1soha_ j.39.1.1 (A:) Fragments of apolipoproteins {Human (Homo sapiens), synthetic, C-II [TaxId: 9606]} tfltqvkeslssywesaktaaqnlyektylpavdeklrdlyskstaamstytgiftdqvl svlkgee
Timeline for d1soha_: